PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00037.1.g03460.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 414aa    MW: 45648.2 Da    PI: 10.145
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00037.1.g03460.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.71.8e-3086136151
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                   kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQ
  Zjn_sc00037.1.g03460.1.am.mk  86 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQ 136
                                   79************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.72383143IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2983137IPR009057Homeodomain-like
SuperFamilySSF466897.53E-1485137IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-2186137IPR006447Myb domain, plants
PfamPF002494.5E-788137IPR001005SANT/Myb domain
PfamPF143795.4E-12130161IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MGGFERTPPR KATVRPLFSA AREPYSLFLN LSIDPNNPTK HQCTRGEKRM FPSKKATSSA  60
AAAVSSNDRP MCVQGDSGLV LTTDPKPRLR WTVELHERFV DAVTQLGGPD KATPKTIMRV  120
MGVKGLTLYH LKSHLQVQKH LQMRIEAQGK YMQSILEKAY QSLASDDVMS FSAGYKSLGN  180
QAVPDVCSLE DISPSMGFPS LQDLHMYGGG HLDLQQQQME RPMESFFACS DSSIGSLGKK  240
RPNLYAASKS PMMWGDDEQG KIISDHLQMA PPMIDGGIDV MDSIAGVYGE VKPMMSGDST  300
GSKGFDGKLE RPSPQRRMDS PSVIGGQNLS YGSCVSLSSD RRSSYYRTHR RARLPRKIIL  360
ERIKATLDAP YRILHCRWVP RARDSKPLEL GSKAARSSAA QQRRGSQIKS PAGP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519555e-70JF951955.1 Aegilops tauschii clone TaMYB72 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951748.11e-122PREDICTED: myb family transcription factor APL
SwissprotQ9SAK52e-55APL_ARATH; Myb family transcription factor APL
TrEMBLK3YTL21e-121K3YTL2_SETIT; Uncharacterized protein
STRINGSi017608m1e-121(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25043890
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.27e-55G2-like family protein